VIP?
£75.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous VPAC1 and VPAC2 agonist.
VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by both neurons and immune cells. VIP has pleiotropic effects as a neurotransmitter, immune regulator, vasodilator and secretagogue. VIP is a master circadian regulator, as its deletion in mice causes a cycling shift in wake/sleep duration with reduced food intake and body weight.
Please contact us for availability.
Additional information
Other Names | VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil |
---|---|
Three Letter Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
Molecular Weight | 3325.8 |
Molecular Formula | C147H238N44O42S |
Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
Solubility | Soluble to 1 mg/ml in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil, 40077-57-4, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, HSDAVFTDNYTRLRKQMAVKKYLNSILN |