TIP 39
£185.00 1mg
Endogenous parathyroid hormone 2 receptor agonist.
TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.
Please contact us for availability.
Additional information
| Other Names | Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues |
|---|---|
| Three Letter Sequence | H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH |
| Molecular Weight | 4504.24 |
| Molecular Formula | C202H325N61O54S |
| Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% |
| Searchable Words | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, TIP 39, TIP39, Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues, PH-020 |