TIP 39

£185.00 1mg

Endogenous parathyroid hormone 2 receptor agonist.

TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.

Please contact us for availability.

SKU: PH-020 Categories: ,

Additional information

Other Names

Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues

Three Letter Sequence

H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH

Molecular Weight

4504.24

Molecular Formula

C202H325N61O54S

Sequence

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95%

Searchable Words

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, TIP 39, TIP39, Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues, PH-020