TIP 39
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous parathyroid hormone 2 receptor agonist.
TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.
Please contact us for availability.
Additional information
| Other Names | Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues |
|---|---|
| Three Letter Sequence | H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH |
| Molecular Weight | 4504.24 |
| Molecular Formula | C202H325N61O54S |
| Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% |
| Searchable Words | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, TIP 39, TIP39, Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues, PH-020 |