TAT-HuR-HNS3
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
HuR-PARP1 interaction blocker.
TAT-HuR-HNS3 is a cell penetrating peptide derived from the human antigen R – nucleocytoplasmic shuttling sequence (HuR-HNS) domain. HuR, also known as embryonic lethal abnormal vision-like 1 (ELAVL1) is a well characterized RNA-binding protein that increases the stability of short lived mRNAs which encode proinflammatory mediators. HuR employs its HNS domain to interact with poly(ADP-ribose) polymerase 1 (PARP1), and intervention by TAT-HuR-HNS3 interrupts this interaction, resulting in lower poly-ADP-ribosylation and decreased cytoplasmic distribution of HuR. TAT-HuR-HNS3 also blocks HuR dimerization and promotes argonaute 2-based miRNA induced silencing complex binding. TAT-HuR-HNS3 lowers the mRNA stability of proinflammatory mediators in TNF-? treated epithelial cells and macrophages, and decreases TNF-? induced inflammatory responses in animal lung models.
Please contact us for availability.
Additional information
Three Letter Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ser-Pro-Met-Gly-Val-Asp-His-Met-Ser-Gly-Leu-Ser-Gly-Val-Asn-Val-Pro-Gly-Asn-Ala-Ser-Ser-Gly-OH |
---|---|
Molecular Weight | 3696.9 |
Molecular Formula | C151H257N59O46S2 |
Sequence | YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG |
Solubility | Soluble in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Searchable Words | TAT-HuR-HNS3, YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG, PP-370, PP370 |