Tat-beclin 1
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Autophagy inducing peptide.
Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
Additional information
| Other Names | Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide |
|---|---|
| Three Letter Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
| Molecular Weight | 3741.15 |
| Molecular Formula | C164H251N57O45 |
| Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | Tat-Beclin 1, 1423821-88-8, PP-200, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide |
