RsAFP2
£245.00 0.1mg
Antifungal plant defensin isolated from radish seeds.
RsAFP2, or raphanus sativus antifungal peptide 2, is an an antifungal plant defensin isolated from seeds of the radish, raphanus sativus, which interacts with glucosylceramides (GlcCer) in the membranes of susceptible yeast and fungi to induce membrane permeabilization and fungal cell death. RsAFP2 is active against Candida albicans and inhibits to a lesser extent other Candida species, and is nontoxic to mammalian cells. In animal models, RsAFP2 is prophylactically effective against murine candidiasis.
Please contact us for availability.
Additional information
| Other Names | Raphanus sativus antifungal peptide 2 |
|---|---|
| Three Letter Sequence | PyroGlu-Lys-Leu-Cys-Gln-Arg-Pro-Ser-Gly-Thr-Trp-Ser-Gly-Val-Cys-Gly-Asn-Asn-Asn-Ala-Cys-Lys-Asn-Gln-Cys-Ile-Arg-Leu-Glu-Lys-Ala-Arg-His-Gly-Ser-Cys-Asn-Tyr-Val-Phe-Pro-Ala-His-Lys-Cys-Ile-Cys-Tyr-Phe-Pro-Cys-OH (disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47) |
| Molecular Weight | 5710.6 |
| Molecular Formula | C244H368N76O68S8 |
| Sequence | PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dark, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | Disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47 |
| Searchable Words | RsAFP2, raphanus sativus antifungal peptide 2, antifungal, defensin, radish, raphanus sativus, glucosylceramides, membrane permeabilization, fungal cell death, AM-140, AM-140 |