RsAFP2

£245.00 0.1mg

Antifungal plant defensin isolated from radish seeds.

RsAFP2, or raphanus sativus antifungal peptide 2, is an an antifungal plant defensin isolated from seeds of the radish, raphanus sativus, which interacts with glucosylceramides (GlcCer) in the membranes of susceptible yeast and fungi to induce membrane permeabilization and fungal cell death. RsAFP2 is active against Candida albicans and inhibits to a lesser extent other Candida species, and is nontoxic to mammalian cells. In animal models, RsAFP2 is prophylactically effective against murine candidiasis.

Please contact us for availability.

SKU: AM-140 Categories: ,

Additional information

Other Names

Raphanus sativus antifungal peptide 2

Three Letter Sequence

PyroGlu-Lys-Leu-Cys-Gln-Arg-Pro-Ser-Gly-Thr-Trp-Ser-Gly-Val-Cys-Gly-Asn-Asn-Asn-Ala-Cys-Lys-Asn-Gln-Cys-Ile-Arg-Leu-Glu-Lys-Ala-Arg-His-Gly-Ser-Cys-Asn-Tyr-Val-Phe-Pro-Ala-His-Lys-Cys-Ile-Cys-Tyr-Phe-Pro-Cys-OH (disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47)

Molecular Weight

5710.6

Molecular Formula

C244H368N76O68S8

Sequence

PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dark, frozen and desiccated

Purity

>95% by HPLC

Modifications

Disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47

Searchable Words

RsAFP2, raphanus sativus antifungal peptide 2, antifungal, defensin, radish, raphanus sativus, glucosylceramides, membrane permeabilization, fungal cell death, AM-140, AM-140