Parathyroid Hormone (1-34) (Rat)

£145.00 1mg

Parathyroid hormone (PTH) receptor agonist.

Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation markers in rat models of osteoarthritis. Parathyroid hormone (1-34) (rat) alleviates disease progression in a papain induced osteoarthritis in vivo rat model.

Please contact us for availability.

SKU: PH-040 Categories: ,

Additional information

Other Names

pTH (1-34) (rat)

Three Letter Sequence

H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Molecular Weight

4057.74

Molecular Formula

C180H291N55O48S2

Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Solubility

Soluble to 1 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by hplc

Searchable Words

Parathyroid hormone (1-34) (rat), PT-040, PT040, PT 040, 98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, PH-040