Parathyroid hormone (1-34) (rat)
£145.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Parathyroid hormone (PTH) receptor agonist.
Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation markers in rat models of osteoarthritis. Parathyroid hormone (1-34) (rat) alleviates disease progression in a papain induced osteoarthritis in vivo rat model.
Please contact us for availability.
Additional information
| Other Names | pTH (1-34) (rat) |
|---|---|
| Three Letter Sequence | H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Molecular Weight | 4057.74 |
| Molecular Formula | C180H291N55O48S2 |
| Sequence | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by hplc |
| Searchable Words | Parathyroid hormone (1-34) (rat), PT-040, PT040, PT 040, 98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, PH-040 |