Pancreatic polypeptide (human)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous agonist for the human NPY Y4 receptor.
Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake.
Please contact us for availability.
Additional information
| Other Names | Pancreatic polypeptide, PP |
|---|---|
| Three Letter Sequence | H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 |
| Molecular Weight | 4181.7 |
| Molecular Formula | C185H287N53O54S2 |
| Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Solubility | Soluble to 0.70 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% |
| Modifications | C-terminal amide |
| Searchable Words | Pancreatic polypeptide (human), 75976-10-2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |