P9R
£175.00 1mg
Defensin like peptide with potent antiviral activity.
P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity of P9R depends on direct binding to viruses and inhibition of virus-host endosomal acidification but when P9R was added to cells after SARS-CoV-2 infection, P9R could significantly inhibit viral replication. P9R can also protect mice in lethal challenge models.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
|---|---|
| Molecular Weight | 3412.1 |
| Molecular Formula | C144H232N52O35S5 |
| Sequence | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
| Solubility | Soluble to 5 ‰mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | P9R, defensin, peptide, antiviral activity, avian influenza, coronavirus, SARS-CoV-2, MERS-CoV , SARS-CoV, rhinovirus, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, CV-060, CV060 |