Oxyntomodulin
£175.00 1mg
Endogenous glucagon like peptide receptor agonist.
Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the GLP-1 receptor antagonist exendin (9-39) and absent in GLP-1 receptor knockout mice. Oxyntomodulin modulates feeding and metabolism and inhibits gastric acid secretion.
Please contact us for availability.
Additional information
| Other Names | OXM, Glucagon 37 |
|---|---|
| Three Letter Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Molecular Weight | 4421.86 |
| Molecular Formula | C192H295N59O60S |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Searchable Words | Oxyntomodulin , endogenous, glucagon-like peptide, GLP-1), anorectic, feeding, metabolism , HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, 62340-29-8, GH-070, GH070 |