Oxyntomodulin
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous glucagon like peptide receptor agonist.
Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the GLP-1 receptor antagonist exendin (9-39) and absent in GLP-1 receptor knockout mice. Oxyntomodulin modulates feeding and metabolism and inhibits gastric acid secretion.
Please contact us for availability.
Additional information
| Other Names | OXM, Glucagon 37 |
|---|---|
| Three Letter Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Molecular Weight | 4421.86 |
| Molecular Formula | C192H295N59O60S |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Searchable Words | Oxyntomodulin , endogenous, glucagon-like peptide, GLP-1), anorectic, feeding, metabolism , HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, 62340-29-8, GH-070, GH070 |