Oxyntomodulin

£175.00 1mg

Endogenous glucagon like peptide receptor agonist.

Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the GLP-1 receptor antagonist exendin (9-39) and absent in GLP-1 receptor knockout mice. Oxyntomodulin modulates feeding and metabolism and inhibits gastric acid secretion.

Please contact us for availability.

SKU: GH-070 Categories: ,

Additional information

Other Names

OXM, Glucagon 37

Three Letter Sequence

H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH

Molecular Weight

4421.86

Molecular Formula

C192H295N59O60S

Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dry, dark and frozen

Purity

>95% by HPLC

Searchable Words

Oxyntomodulin , endogenous, glucagon-like peptide, GLP-1), anorectic, feeding, metabolism , HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, 62340-29-8, GH-070, GH070