NT1-20
£175.00 1mg
Blocks ASIC1a binding to RIPK1.
NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a ?mediates necroptosis via recruiting RIPK1, independent of its ion-conducting function, and though this mechanism NT1-20 can protect neurons against acidosis induced necroptosis in vitro. NT1-20 can also reduce neuronal damage in mouse models of ischemic stroke.
Please contact us for availability.
Additional information
| Other Names | Peptide NT1 “20 |
|---|---|
| Three Letter Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH |
| Molecular Weight | 3655.22 |
| Molecular Formula | C150H265N55O47S2 |
| Sequence | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | AS-010, NT1 “20, GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20 |