NT1-20

£175.00 1mg

Blocks ASIC1a binding to RIPK1.

NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a ?mediates necroptosis via recruiting RIPK1, independent of its ion-conducting function, and though this mechanism NT1-20 can protect neurons against acidosis induced necroptosis in vitro. NT1-20 can also reduce neuronal damage in mouse models of ischemic stroke.

Please contact us for availability.

SKU: AS-010 Categories: ,

Additional information

Other Names

Peptide NT1 “20

Three Letter Sequence

H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH

Molecular Weight

3655.22

Molecular Formula

C150H265N55O47S2

Sequence

GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

AS-010, NT1 “20, GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20