Neuromedin S (Human)

£175.00 1mg

Endogenous neuromedin U receptor agonist.

Neuromedin S (human) is a 33-amino acid neuropeptide, originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have since been identified as the neuromedin U receptors NMU1 and NMU2. Neuromedin S (human) shares an identical C-terminal heptapeptide with human neuromedin U, but unlike human neuromedin U, which is widely distributed in the CNS and peripheral tissues, neuromedin S (human) mainly exists in the suprachiasmatic nucleus in the CNS. Neuromedin S (human) primarily regulates biological rhythms.

Please contact us for availability.

SKU: NU-010 Categories: ,

Additional information

Other Names

NMS (human), hNMS-33

Molecular Weight

3789.01

Molecular Formula

C173H265N53O44

Sequence

ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

NMS, NU010, NU-010, ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2, ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN, 1138204-27-9, H-6232, hNMS-33