mCRAMP (Mouse)
£145.00 1mg
Sole murine cathelicidin and homologue of human LL 37.
mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.
Please contact us for availability.
Additional information
| Other Names | Mouse calethicidin related antimicrobial peptide |
|---|---|
| Three Letter Sequence | H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH |
| Molecular Weight | 3878.7 |
| Molecular Formula | C178H302N50O46 |
| Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin, antimicrobial activity, AM-040, AM040 |