GLP-1 (9-36) Amide
£145.00 1mg
Major metabolite of glucagon like peptide GLP-1 (7-36) amide.
GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36) amide acts as an antagonist at the human GLP-1 receptor, inhibits hepatic glucose production and is a weak insulinotropic agent.
Please contact us for availability.
Additional information
| Other Names | Glucagon-like peptide-1 (9-36) amide |
|---|---|
| Three Letter Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Weight | 3089.4 |
| Molecular Formula | C140H214N36O43 |
| Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | GLP-1 (9-36) amide, Glucagon-like peptide-1-(9-36) amide, glucoregulatory, metabolite, GLP-1 receptor, insulinotropic , H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, EGTFTSDVSSYLEGQAAKEFIAWLVKGR, 161748-29-4, GH-040, GH040 |