GLP-1 (9-36) Amide

£145.00 1mg

Major metabolite of glucagon like peptide GLP-1 (7-36) amide.

GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36) amide acts as an antagonist at the human GLP-1 receptor, inhibits hepatic glucose production and is a weak insulinotropic agent.

Please contact us for availability.

SKU: GH-040 Categories: ,

Additional information

Other Names

Glucagon-like peptide-1 (9-36) amide

Three Letter Sequence

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Molecular Weight

3089.4

Molecular Formula

C140H214N36O43

Sequence

EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dry, frozen and desiccated

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

GLP-1 (9-36) amide, Glucagon-like peptide-1-(9-36) amide, glucoregulatory, metabolite, GLP-1 receptor, insulinotropic , H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, EGTFTSDVSSYLEGQAAKEFIAWLVKGR, 161748-29-4, GH-040, GH040