GLP-1 (7-36) Amide (Human, Rat)

£145.00 1mg

Insulinotropic incretin peptide hormone.

GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic ?-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Please contact us for availability.

SKU: GH-050 Categories: ,

Additional information

Three Letter Sequence

H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Molecular Weight

3297.7

Molecular Formula

C149H226N40O45

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dry, frozen and desiccated

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 107444-51-9, GLP-1 (7-36) amide, insulinotropic, hormone, proglucagon, GLP-1 receptor, antiapoptotic