GLP-1 (7-36) Amide (Human, Rat)
£145.00 1mg
Insulinotropic incretin peptide hormone.
GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic ?-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
|---|---|
| Molecular Weight | 3297.7 |
| Molecular Formula | C149H226N40O45 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 107444-51-9, GLP-1 (7-36) amide, insulinotropic, hormone, proglucagon, GLP-1 receptor, antiapoptotic |