GIP (Porcine)

£125.00 1mg

SKU: GL-020 Categories: ,

Stimulates insulin secretion.

GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the epithelium of the upper part of small intestine after ingestion of food. Once released, GIP is subjected to NH2-terminal degradation by dipeptidyl peptidase-IV (DPP-IV), yielding GIP (3-42) as the primary metabolite which acts as a GIP receptor antagonist.

Please contact us for availability.

Additional information

Other Names

Glucose dependent insulinotropic polypeptide (porcine), Gastric inhibitory peptide (porcine)

Three Letter Sequence

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

Molecular Weight

4975.62

Molecular Formula

C225H342N60O66S

Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

GIP (porcine), Glucose-Dependent Insulinotropic Polypeptide (porcine), Gastric Inhibitory Peptide, porcine, GL-020, GL020