GIP (porcine)?
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Stimulates insulin secretion.
GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the epithelium of the upper part of small intestine after ingestion of food. Once released, GIP is subjected to NH2-terminal degradation by dipeptidyl peptidase-IV (DPP-IV), yielding GIP (3-42) as the primary metabolite which acts as a GIP receptor antagonist.
Please contact us for availability.
Additional information
| Other Names | Glucose dependent insulinotropic polypeptide (porcine), Gastric inhibitory peptide (porcine) |
|---|---|
| Three Letter Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
| Molecular Weight | 4975.62 |
| Molecular Formula | C225H342N60O66S |
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | GIP (porcine), Glucose-Dependent Insulinotropic Polypeptide (porcine), Gastric Inhibitory Peptide, porcine, GL-020, GL020 |