Galanin (Human)

£125.00 1mg

Endogenous galanin receptor agonist.

Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expressed in the central and peripheral nervous system as well as in the endocrine system and co-exists with a number of classical neurotransmitters. Galanin (human) is also linked to cognitive deficits in Alzheimer’s disease.

Please contact us for availability.

SKU: GA-020 Categories: ,

Additional information

Other Names

Galanin (1-30) (human)

Three Letter Sequence

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH

Molecular Weight

3155.55

Molecular Formula

C139H210N42O43

Sequence

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Solubility

Soluble to 0.50 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

Galanin (human), GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, 119418-04-1