Galanin (human)
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous galanin receptor agonist.
Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expressed in the central and peripheral nervous system as well as in the endocrine system and co-exists with a number of classical neurotransmitters. Galanin (human) is also linked to cognitive deficits in Alzheimer’s disease.
Please contact us for availability.
Additional information
Other Names | Galanin (1-30) (human) |
---|---|
Three Letter Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH |
Molecular Weight | 3155.55 |
Molecular Formula | C139H210N42O43 |
Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
Solubility | Soluble to 0.50 mg/ml in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Searchable Words | Galanin (human), GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, 119418-04-1 |