Galanin (Human)
£125.00 1mg
Endogenous galanin receptor agonist.
Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expressed in the central and peripheral nervous system as well as in the endocrine system and co-exists with a number of classical neurotransmitters. Galanin (human) is also linked to cognitive deficits in Alzheimer’s disease.
Please contact us for availability.
Additional information
Other Names | Galanin (1-30) (human) |
---|---|
Three Letter Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH |
Molecular Weight | 3155.55 |
Molecular Formula | C139H210N42O43 |
Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
Solubility | Soluble to 0.50 mg/ml in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Searchable Words | Galanin (human), GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, 119418-04-1 |