Galanin (1-29) (rat, mouse)
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Galanin receptor agonist.
Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Ki values of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Galanin (1-29) (rat, mouse) is an anticonvulsant which can prevent the occurrence of full kindled seizures in rats. Galanin (1-29) (rat, mouse) causes orexigenic effects in a variety of species.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
|---|---|
| Molecular Weight | 3164.48 |
| Molecular Formula | C141H211N43O41 |
| Sequence | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C-terminal amide |
| Searchable Words | 114547-31-8, GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, Galanin (1-29) (rat, mouse) |