Exendin-4 (3-39) amide
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Glucagon like peptide 1 (GLP-1) receptor antagonist.
Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|---|---|
| Molecular Weight | 3992.4 |
| Molecular Formula | C176H272N46O58S |
| Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin-4 (3-39) amide, glucagon-like peptide 1, GLP-1, antagonist, 196109-31-6, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-008, GH008 |