Exendin-4 (3-39) Amide

£185.00 1mg

Glucagon like peptide 1 (GLP-1) receptor antagonist.

Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide.

Please contact us for availability.

SKU: GH-008 Categories: ,

Additional information

Three Letter Sequence

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Molecular Weight

3992.4

Molecular Formula

C176H272N46O58S

Sequence

EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

Exendin-4 (3-39) amide, glucagon-like peptide 1, GLP-1, antagonist, 196109-31-6, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-008, GH008