Exendin-4 (3-39) Amide
£185.00 1mg
Glucagon like peptide 1 (GLP-1) receptor antagonist.
Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|---|---|
| Molecular Weight | 3992.4 |
| Molecular Formula | C176H272N46O58S |
| Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin-4 (3-39) amide, glucagon-like peptide 1, GLP-1, antagonist, 196109-31-6, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-008, GH008 |