D1 peptide
£95.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Inhibits IL-13 binding to IL13R2.
D1 is a peptide containing the 81-WKTIITKN-88 conserved sequence from the IL13R?2 binding site, the full sequence being that which interacts directly with IL-13 in site III. IL13R?2 is a cancer/testis-like tumour antigen that is overexpressed in various tumours, and in colorectal cancer, IL13R?2 expression is associated with late stage disease and lower overall survival. D1 blocks IL-13 binding to IL13R2 with near complete inhibition at 50g/ml, and in metastatic colorectal and glioblastoma cancer cells treated with IL-13, D1 peptide inhibits migration, invasion, and proliferation. In vivo, D1 peptide causes a modest increase in survival of mice innoculated with KM12SM colonic cancer cells preincubated with D1, but in contrast, the more stable D1 enantiomer consisting of all D amino acids, D-D1, causes a remarkable increase in survival in animal models, with 40% of mice surviving the experimental endpoint without metastatic lesions in liver. In glioblastoma xenografts, D-D1 peptide administration causes significant growth arrest accompanied by a regression in tumour size. Please contact us for the D-D1 peptide.
Please contact us for availability.
Additional information
| Other Names | IL13Rα2 Peptide |
|---|---|
| Three Letter Sequence | H-Gly-Ser-Glu-Thr-Trp-Lys-Thr-Ile-Ile-Thr-Lys-Asn-OH |
| Molecular Weight | 1376.73 |
| Molecular Formula | C61H100N16O20 |
| Sequence | GSETWKTIITKN |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | H-CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Cys-LL 37, host defence peptide, LL 37, N-terminal cysteine, Am-180, AM180 |
