Cecropin B

£185.00 1mg

SKU: AM-081 Categories: ,

Broad spectrum insect antimicrobial peptide.

Cecropin B is a natural linear cationic ?-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects.

Additional information

Three Letter Sequence

H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2

Molecular Weight

3834.7

Molecular Formula

C176H302N52O41S

Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, 80451-05-4, Cecropin B, antimicrobial, AMP