Neuropeptide Y (human, rat)
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous neuropeptide Y receptor agonist.
Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
|---|---|
| Molecular Weight | 4271.7 |
| Molecular Formula | C189H285N55O57S |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store in the dark, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Neuropeptide Y, NPY, endogenous neuropeptide, blood pressure regulation, 90880-35-6, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, GH-060, GH060 |
