GLP-1 (9-36) amide
£145.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Major metabolite of glucagon like peptide GLP-1 (7-36) amide.
GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36) amide acts as an antagonist at the human GLP-1 receptor, inhibits hepatic glucose production and is a weak insulinotropic agent.
Please contact us for availability.
Additional information
| Other Names | Glucagon-like peptide-1 (9-36) amide |
|---|---|
| Three Letter Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Weight | 3089.4 |
| Molecular Formula | C140H214N36O43 |
| Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | GLP-1 (9-36) amide, Glucagon-like peptide-1-(9-36) amide, glucoregulatory, metabolite, GLP-1 receptor, insulinotropic , H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, EGTFTSDVSSYLEGQAAKEFIAWLVKGR, 161748-29-4, GH-040, GH040 |