GLP-1 (7-36) amide (human, rat)
£145.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Insulinotropic incretin peptide hormone.
GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic ?-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
|---|---|
| Molecular Weight | 3297.7 |
| Molecular Formula | C149H226N40O45 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 107444-51-9, GLP-1 (7-36) amide, insulinotropic, hormone, proglucagon, GLP-1 receptor, antiapoptotic |
