NT1-20
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Blocks ASIC1a binding to RIPK1.
NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a ?mediates necroptosis via recruiting RIPK1, independent of its ion-conducting function, and though this mechanism NT1-20 can protect neurons against acidosis induced necroptosis in vitro. NT1-20 can also reduce neuronal damage in mouse models of ischemic stroke.
Please contact us for availability.
Additional information
| Other Names | Peptide NT1 “20 |
|---|---|
| Three Letter Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH |
| Molecular Weight | 3655.22 |
| Molecular Formula | C150H265N55O47S2 |
| Sequence | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | AS-010, NT1 “20, GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20 |
