LL 37 (human) biotinylated
£225.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
N-terminally biotinylated version of the host defence peptide LL 37.
LL 37 (human) biotinylated is the N-terminally biotinylated version of the host defence peptide LL 37. The biotin group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the biotin tag allows numerous biochemical and microbiological applications. We also offer unlabelled LL 37 (AM-001) and the carboxyfluoresceinated version of LL 37 (AM-004).
Please contact us for availability.
Additional information
Three Letter Sequence | Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
---|---|
Molecular Weight | 4832.5 |
Molecular Formula | C221H366N64O55S |
Sequence | Biotin-Ahx[LL-37, 37 aa] |
Solubility | Soluble in water |
Appearance | Freeze dried solid |
Storage | Store dark, frozen and desiccated. |
Purity | >95% by HPLC |
Modifications | Biotin attached to the N terminal via a 6-aminohexanoic acid linker |
Searchable Words | [LL-37, 37 aa], LL 37 (human) biotinylated, N-terminally biotinylated, host defence, 6-carbon spacer, 6-aminohexanoic acid, Ahx, biotin tag , LL37 (human) biotinylated, AM-003, AM003 |