P9R
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Defensin like peptide with potent antiviral activity.
P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity of P9R depends on direct binding to viruses and inhibition of virus-host endosomal acidification but when P9R was added to cells after SARS-CoV-2 infection, P9R could significantly inhibit viral replication. P9R can also protect mice in lethal challenge models.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
|---|---|
| Molecular Weight | 3412.1 |
| Molecular Formula | C144H232N52O35S5 |
| Sequence | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
| Solubility | Soluble to 5 ‰mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | P9R, defensin, peptide, antiviral activity, avian influenza, coronavirus, SARS-CoV-2, MERS-CoV , SARS-CoV, rhinovirus, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, CV-060, CV060 |
