mCRAMP (mouse)
£145.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Sole murine cathelicidin and homologue of human LL 37.
mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.
Please contact us for availability.
Additional information
| Other Names | Mouse calethicidin related antimicrobial peptide |
|---|---|
| Three Letter Sequence | H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH |
| Molecular Weight | 3878.7 |
| Molecular Formula | C178H302N50O46 |
| Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin, antimicrobial activity, AM-040, AM040 |
