WaTx
£195.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Stabilizes the transient receptor potential cation channel 1 (TRPA1) in an active state.
WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain.
Please contact us for availability.
Additional information
Other Names | Wasabi receptor toxin |
---|---|
Three Letter Sequence | H-Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser-OH (disulphide bridge between C9 and C27 and C13 and C23) |
Molecular Weight | 3855.3 |
Molecular Formula | C164H245N45O53S5 |
Sequence | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS |
Solubility | Soluble in DMSO as stock. |
Appearance | Freeze dried solid |
Storage | Storage desiccated, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | Disulphide bridges between cysteine 9 and cysteine 27 and cysteine 13 and cysteine 23 |
Searchable Words | WaTx, WaTx, wasabi receptor toxin, venom, black rock scorpion Urodacus manicous, transient receptor potential cation channel 1, TRPA1, pain , H-ASPQQAKYC*YEQC*NVNKVPFDQC*YQMC*SPLERS-OH (disulphide bridge between C 9 and C 27 and C 13 and C23, ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS, PN-120, PN120 |