VIP

£75.00 1mg

Endogenous VPAC1 and VPAC2 agonist.

VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by both neurons and immune cells. VIP has pleiotropic effects as a neurotransmitter, immune regulator, vasodilator and secretagogue. VIP is a master circadian regulator, as its deletion in mice causes a cycling shift in wake/sleep duration with reduced food intake and body weight.

Please contact us for availability.

SKU: VP-010 Categories: ,

Additional information

Other Names

VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil

Three Letter Sequence

H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

Molecular Weight

3325.8

Molecular Formula

C147H238N44O42S

Sequence

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Solubility

Soluble to 1 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil, 40077-57-4, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, HSDAVFTDNYTRLRKQMAVKKYLNSILN