tatM2NX

£185.00 1mg

Cell permeable TRPM2 antagonist.

tatM2NX is a peptide generated by fusing part of the C-terminus of transient receptor potential melastin 2 (TRPM2) channels, corresponding more than 90% with the Nudix domain (M2NX), with the tat inducer of HIV. tatM2NX is a TRPM2 antagonist which prevents ligand binding and TRPM2 activation, and inhibits over 90% of human TRPM2 channel currents at concentrations as low as 2 μM. tatM2NX is an antagonist with an IC50 of 396 nM and is neuroprotective in animal models of focal and global ischemia.

Please contact us for availability.

SKU: TP-010 Categories: ,

Additional information

Three Letter Sequence

H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH

Molecular Weight

4354.17

Molecular Formula

C190H323N71O45 S

Sequence

YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

tatM2NX, YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV, TP-010, TP010