Tat-beclin 1
£125.00 1mg
Autophagy inducing peptide.
Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
Additional information
| Other Names | Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide |
|---|---|
| Three Letter Sequence | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
| Molecular Weight | 3741.15 |
| Molecular Formula | C164H251N57O45 |
| Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | Tat-Beclin 1, 1423821-88-8, PP-200, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide |