sfTSLP (63 aa peptide)
£225.00 0.1mg
Antimicrobial, the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP).
sfTSLP (63 aa peptide) is an antibacterial peptide derived as the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth factor produced by a thymic stromal cell line. Two transcript variants of human TSLP are described: a long form of TSLP (lfTSLP, variant 1) and an alternative, short form (sfTSLP, variant 2). The sequence of sfTSLP has two potential starting methionines that can give rise to either a 63 or a 60 aa peptide. Compared with lfTSLP, sfTSLP possesses stronger antibacterial activity and appears to act as an antimicrobial peptide in the oral cavity and on the skin to create a defense barrier that aids in the control microbes.
Please contact us for availability.
Additional information
Three Letter Sequence | H-Met-Phe-Ala-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH |
---|---|
Molecular Weight | 7425.86 |
Molecular Formula | C327H543N101O86S5 |
Sequence | MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Searchable Words | sfTSLP, 63 aa peptide, MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |