SFKEELDKYFKNHTSP

£129.00 1mg

SKU: EP-020 Categories: ,

Epitope from the ?S2 protein of SARS-CoV-2.

SFKEELDKYFKNHTSP is a truncated peptide derived from the P4 peptide of the S2 subunit of the S protein of SARS-CoV-2 which has the amino acid sequence DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS, corresponding to residues 1139-1170. The P4 peptide is located in the linker region between heptad repeat 1 (HR1) and heptad repeat 2 (HR2) and is highly conserved among SARS-CoV, BatCoV RaTG13, SARS-CoV-2 and recent SARS-CoV-2 variants. Antibodies targeting the peptide SFKEELDKYFKNHTSP can neutralize both SARS-CoV-2 and SARS-CoV by preventing fusion between the virus and the cell membrane.

Please contact us for availability.

Additional information

Other Names

truncated P4, 1147SFKEELDKYFKNHTSP1162

Three Letter Sequence

H-Ser-Phe-Lys-Glu-Glu-Leu-Asp-Lys-Tyr-Phe-Lys-Asn-His-Thr-Ser-Pro-OH

Molecular Weight

1970.16

Molecular Formula

C90 H132N22O28

Sequence

SFKEELDKYFKNHTSP

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

EP-020, SFKEELDKYFKNHTSP, 1147SFKEELDKYFKNHTSP1162, truncated P4