SFKEELDKYFKNHTSP
£129.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Epitope from the ?S2 protein of SARS-CoV-2.
SFKEELDKYFKNHTSP is a truncated peptide derived from the P4 peptide of the S2 subunit of the S protein of SARS-CoV-2 which has the amino acid sequence DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS, corresponding to residues 1139-1170. The P4 peptide is located in the linker region between heptad repeat 1 (HR1) and heptad repeat 2 (HR2) and is highly conserved among SARS-CoV, BatCoV RaTG13, SARS-CoV-2 and recent SARS-CoV-2 variants. Antibodies targeting the peptide SFKEELDKYFKNHTSP can neutralize both SARS-CoV-2 and SARS-CoV by preventing fusion between the virus and the cell membrane.
Please contact us for availability.
Additional information
| Other Names | truncated P4, 1147SFKEELDKYFKNHTSP1162 |
|---|---|
| Three Letter Sequence | H-Ser-Phe-Lys-Glu-Glu-Leu-Asp-Lys-Tyr-Phe-Lys-Asn-His-Thr-Ser-Pro-OH |
| Molecular Weight | 1970.16 |
| Molecular Formula | C90 H132N22O28 |
| Sequence | SFKEELDKYFKNHTSP |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | EP-020, SFKEELDKYFKNHTSP, 1147SFKEELDKYFKNHTSP1162, truncated P4 |
