RG33

£175.00 1mg

Apolipoprotein A1 (ApoA-I) mimetic, improves glucose clearance and control.

RG33 is a peptide corresponding to the two last helical segments, amino acid residues 209-241 of apolipoprotein A1 (ApoA-I), the major protein component of high-density lipoprotein (HDL) particles in plasma. ApoA-I has a specific role in lipid metabolism and enables efflux of molecules by accepting fats from within cells for transport and metabolism elsewhere. In vivo RG33 peptide efficiently solubilizes lipid vesicles, and promotes the efflux of cholesterol from cultured macrophages. In vitro RG33 peptide significantly improves the glucose clearance capacity of insulin resistant mice and provides systemic glucose control in an insulin resistant mouse model.

Please contact us for availability.

SKU: GH-220 Categories: ,

Additional information

Three Letter Sequence

Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2

Molecular Weight

3790.41

Molecular Formula

C175H282N42O51

Sequence

Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2

Solubility

>3 mg/ml in water

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

N terminal acetyl, C terminal amide

Searchable Words

RG33, amino acid residues 209 “241 of apolipoprotein A1, ApoA-I, lipid metabolism, Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2, PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN, GH-220, GH220