Peptide YY (Human)

£175.00 1mg

Neuropeptide Y agonist that binds all subtypes with similar affinity.

Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.

Please contact us for availability.

SKU: GH-110 Categories: ,

Additional information

Other Names

PYY, PYY (1-36)

Three Letter Sequence

H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Molecular Weight

4049.5

Molecular Formula

C194H295N55O57

Sequence

YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 118997-30-1, Peptide YY, PYY, PYY (1-36), Peptide YY, neuropeptide Y, NPY, food ingestion, gut motility, insulin secretion, obesity, diabetes, GH-110, GH110