Peptide YY (human)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Neuropeptide Y agonist that binds all subtypes with similar affinity.
Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.
Please contact us for availability.
Additional information
Other Names | PYY, PYY (1-36) |
---|---|
Three Letter Sequence | H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Molecular Weight | 4049.5 |
Molecular Formula | C194H295N55O57 |
Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
Solubility | Soluble in dilute acid |
Appearance | Freeze dried solid |
Storage | Store desiccated, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 118997-30-1, Peptide YY, PYY, PYY (1-36), Peptide YY, neuropeptide Y, NPY, food ingestion, gut motility, insulin secretion, obesity, diabetes, GH-110, GH110 |