Peptide YY (3-36) (human)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Neuropeptide Y2 receptor agonist.
PYY (3-36) is the N-terminal truncated metabolite of PYY1 36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
|---|---|
| Molecular Weight | 4049.6 |
| Molecular Formula | C180H279N53O54 |
| Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1, PYY (3-36), metabolite, PYY1 “36, appetite , Y2 receptor agonist, food intake, weight gain, GH-120, GH120 |
