Peptide YY (3-36) (Human)
£175.00 1mg
Neuropeptide Y2 receptor agonist.
PYY (3-36) is the N-terminal truncated metabolite of PYY1 36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
|---|---|
| Molecular Weight | 4049.6 |
| Molecular Formula | C180H279N53O54 |
| Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1, PYY (3-36), metabolite, PYY1 “36, appetite , Y2 receptor agonist, food intake, weight gain, GH-120, GH120 |