Parathyroid Hormone (1-34) (Human)

£125.00 1mg

Parathyroid hormone receptor agonist.

Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.

Please contact us for availability.

SKU: PH-010 Categories: ,

Additional information

Other Names

PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)

Three Letter Sequence

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Molecular Weight

4117.77

Molecular Formula

C181H291N55O51S2

Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Solubility

Soluble to 0.40 mg/ml in water

Appearance

Freeze fried solid

Storage

Store in the dark, frozen and dessicated

Purity

>95%

Searchable Words

PTH 1-34, hPTH (1-34), Teriparatide, Parathyroid hormone (1-34) (human), 52232-67-4, SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, Human parathyroid hormone (1-34), PH-010