Parathyroid hormone (1-34) (human)
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Parathyroid hormone receptor agonist.
Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.
Please contact us for availability.
Additional information
| Other Names | PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34) |
|---|---|
| Three Letter Sequence | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Molecular Weight | 4117.77 |
| Molecular Formula | C181H291N55O51S2 |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Solubility | Soluble to 0.40 mg/ml in water |
| Appearance | Freeze fried solid |
| Storage | Store in the dark, frozen and dessicated |
| Purity | >95% |
| Searchable Words | PTH 1-34, hPTH (1-34), Teriparatide, Parathyroid hormone (1-34) (human), 52232-67-4, SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, Human parathyroid hormone (1-34), PH-010 |
