Pancreatic Polypeptide (Human)

£175.00 1mg

Endogenous agonist for the human NPY Y4 receptor.

Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake.

Please contact us for availability.

SKU: NY-030 Categories: ,

Additional information

Other Names

Pancreatic polypeptide, PP

Three Letter Sequence

H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

Molecular Weight

4181.7

Molecular Formula

C185H287N53O54S2

Sequence

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Solubility

Soluble to 0.70 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95%

Modifications

C-terminal amide

Searchable Words

Pancreatic polypeptide (human), 75976-10-2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY