PACAP (6-38)

£165.00 1mg

PAC1 receptor antagonist.

PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist with an IC50 of 2 nM. PACAP(6-38)] is a potent mast cell degranulator and has an agonistic effect on MrgB3-receptors expressed in oocytes. PACAP (6-38) acts as a functional Cocaine- and amphetamine-regulated transcript peptides (CARTp) antagonist in vivo and blocks its effects on feeding and short-term weight gain.

Please contact us for availability.

SKU: PA-030 Categories: ,

Additional information

Other Names

PACAP 6-38, Pituitary adenylate cyclase activating polypeptide (6-38)

Three Letter Sequence

H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-OH

Molecular Weight

4024.8

Molecular Formula

C182H300N56O45S

Sequence

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Solubility

Soluble to 2 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

PACAP 6-38, PACAP (6-38), 143748-18-9, FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2