PACAP (6-38)
£165.00 1mg
PAC1 receptor antagonist.
PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist with an IC50 of 2 nM. PACAP(6-38)] is a potent mast cell degranulator and has an agonistic effect on MrgB3-receptors expressed in oocytes. PACAP (6-38) acts as a functional Cocaine- and amphetamine-regulated transcript peptides (CARTp) antagonist in vivo and blocks its effects on feeding and short-term weight gain.
Please contact us for availability.
Additional information
| Other Names | PACAP 6-38, Pituitary adenylate cyclase activating polypeptide (6-38) |
|---|---|
| Three Letter Sequence | H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-OH |
| Molecular Weight | 4024.8 |
| Molecular Formula | C182H300N56O45S |
| Sequence | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| Solubility | Soluble to 2 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | PACAP 6-38, PACAP (6-38), 143748-18-9, FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |