PACAP 38

£185.00 1mg

Endogenous PAC1 receptor agonist.

PACAP 38, or Pituitary adenylate cyclase activating polypeptide-38, is a widely distributed endogenous neuropeptide located in both sensory and parasympathetic perivascular nerve fibes. PACAP 38 acts primarily as a PAC1 agonist and is involved in neuroprotection, neurodevelopment, nociception and inflammation. PACAP 38 is a potent inducer of migraine like attacks in migraineurs and headache in non migraineurs.

Please contact us for availability.

SKU: PA-020 Categories: ,

Additional information

Other Names

Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, PACAP 1-38

Three Letter Sequence

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Molecular Weight

4534.32

Molecular Formula

C ‚‚ ‚ ‚ƒH ‚ƒ ‚ƒ ‚N ‚† ‚ƒO ‚… ‚ƒS

Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH ‚‚

Solubility

Soluble to 0.90 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

95% by HPLC

Modifications

C terminal amide

Searchable Words

PACAP 38, PACAP38, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH ‚‚, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK, 124123-15-5