PACAP 27
£175.00 1mg
Endogenous PAC1 receptor agonist.
PACAP 27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.
Please contact us for availability.
Additional information
| Other Names | PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat) |
|---|---|
| Three Letter Sequence | H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
| Molecular Weight | 3147.65 |
| Molecular Formula | C142H224N40O39S |
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | PACAP-27, PACAP27, 127317-03-7, PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, HSDGIFTDSYSRYRKQMAVKKYLAAVL, PA-010, PA010 |