Neuropeptide Y (Human, Rat)

£125.00 1mg

Endogenous neuropeptide Y receptor agonist.

Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.

Please contact us for availability.

SKU: GH-060 Categories: ,

Additional information

Three Letter Sequence

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Molecular Weight

4271.7

Molecular Formula

C189H285N55O57S

Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store in the dark, frozen and desiccated

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

Neuropeptide Y, NPY, endogenous neuropeptide, blood pressure regulation, 90880-35-6, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, GH-060, GH060