Neuropeptide Y (Human, Rat)
£125.00 1mg
Endogenous neuropeptide Y receptor agonist.
Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.
Please contact us for availability.
Additional information
Three Letter Sequence | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
---|---|
Molecular Weight | 4271.7 |
Molecular Formula | C189H285N55O57S |
Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
Solubility | Soluble in dilute acid |
Appearance | Freeze dried solid |
Storage | Store in the dark, frozen and desiccated |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | Neuropeptide Y, NPY, endogenous neuropeptide, blood pressure regulation, 90880-35-6, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, GH-060, GH060 |