Melittin, C-terminal cysteine labelled
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Synthetic melittin with an extra cysteine residue at the C terminal.
Melittin, C-terminal cysteine labelled is synthetic melittin with an extra cysteine residue at the C terminal. Melittin is a cationic, haemolytic component of honey bee venom used to study cell and liposome lysis. Melittin is a positively charged, amphipathic 26-amino-acid peptide that associates with the phospholipids of membrane bilayers, causing cell death by forming transmembrane toroidal pores at nanomolar concentrations.
Melittin, C-terminal cysteine labelled, can be labelled with any maleimide linked tag to generate fluorescent or biotinylated derivatives.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-Cys-NH2 |
|---|---|
| Molecular Weight | 2949.63 |
| Molecular Formula | C134H234N40O32S |
| Sequence | GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C-terminal amide |
| Searchable Words | H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2, GIGAVLKVLTTGLPALISWIKRKRQQC, Melittin, maleimide linked tag, fluorescent, biotinylated, AM-210, AM210 |
