Melittin, C-Terminal Cysteine Labelled

£175.00 1mg

Synthetic melittin with an extra cysteine residue at the C terminal.

Melittin, C-terminal cysteine labelled is synthetic melittin with an extra cysteine residue at the C terminal. Melittin is a cationic, haemolytic component of honey bee venom used to study cell and liposome lysis. Melittin is a positively charged, amphipathic 26-amino-acid peptide that associates with the phospholipids of membrane bilayers, causing cell death by forming transmembrane toroidal pores at nanomolar concentrations.
Melittin, C-terminal cysteine labelled, can be labelled with any maleimide linked tag to generate fluorescent or biotinylated derivatives.

Please contact us for availability.

SKU: AM-210 Categories: ,

Additional information

Three Letter Sequence

H-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-Cys-NH2

Molecular Weight

2949.63

Molecular Formula

C134H234N40O32S

Sequence

GIGAVLKVLTTGLPALISWIKRKRQQC-NH2

Solubility

Soluble in dilute acid and physiological buffers

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C-terminal amide

Searchable Words

H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2, GIGAVLKVLTTGLPALISWIKRKRQQC, Melittin, maleimide linked tag, fluorescent, biotinylated, AM-210, AM210