LL 37 (human)

£125.00 1mg

SKU: AM-001 Categories: , ,

Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

Host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide.

LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to A42, LL 37 (human) expression impacts initiation and progression of Alzheimer’s disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.

Please contact us for availability.

Additional information

Other Names

Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human)

Three Letter Sequence

H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Molecular Weight

4493.3

Molecular Formula

C205H340N60O53

Sequence

[LL-37, 37 aa]

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, dark and frozen

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, [LL-37, 37 aa], 154947-66-7, LL 37, human cathelicidin antimicrobial peptide, CAMP, hCAP18, antimicrobial, antiviral, immunomodulatory, chemotaxis, wound closure, angiogenesis, autoimmune and inflammatory diseases, atherosclerosis, AM-001, AM001, LL37, Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human)