LL 37 (human)
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide.
LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to A42, LL 37 (human) expression impacts initiation and progression of Alzheimer’s disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.
Please contact us for availability.
Additional information
| Other Names | Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human) |
|---|---|
| Three Letter Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
| Molecular Weight | 4493.3 |
| Molecular Formula | C205H340N60O53 |
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, 154947-66-7, LL 37, human cathelicidin antimicrobial peptide, CAMP, hCAP18, antimicrobial, antiviral, immunomodulatory, chemotaxis, wound closure, angiogenesis, autoimmune and inflammatory diseases, atherosclerosis, AM-001, AM001, LL37, Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human) |
