LL 37 (Human) Scrambled
£125.00 1mg
Scrambled control peptide for LL-37.
LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. LL 37 (human) scrambled is the control peptide for LL-37 [AM-001].
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH |
|---|---|
| Molecular Weight | 4493.3 |
| Molecular Formula | C205H340N60O53 |
| Sequence | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| Purity | >95% by HPLC |
| Searchable Words | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, LL 37, host defence peptide, human cathelicidin antimicrobial peptide (CAMP, hCAP18), LL 37 (human) scrambled, control , LL37, AM-002, AM002 |