LL 37 (Human) Scrambled

£125.00 1mg

Scrambled control peptide for LL-37.

LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. LL 37 (human) scrambled is the control peptide for LL-37 [AM-001].

Please contact us for availability.

SKU: AM-002 Categories: ,

Additional information

Three Letter Sequence

H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH

Molecular Weight

4493.3

Molecular Formula

C205H340N60O53

Sequence

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dry, dark and frozen

Purity

>95% by HPLC

Searchable Words

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, LL 37, host defence peptide, human cathelicidin antimicrobial peptide (CAMP, hCAP18), LL 37 (human) scrambled, control , LL37, AM-002, AM002