LL 37 (Human) Biotinylated

£225.00 1mg

N-terminally biotinylated version of the host defence peptide LL 37.

LL 37 (human) biotinylated is the N-terminally biotinylated version of the host defence peptide LL 37. The biotin group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the biotin tag allows numerous biochemical and microbiological applications. We also offer unlabelled LL 37 (AM-001) and the carboxyfluoresceinated version of LL 37 (AM-004).

Please contact us for availability.

SKU: AM-003 Categories: ,

Additional information

Three Letter Sequence

Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Molecular Weight

4832.5

Molecular Formula

C221H366N64O55S

Sequence

Biotin-Ahx[LL-37, 37 aa]

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dark, frozen and desiccated.

Purity

>95% by HPLC

Modifications

Biotin attached to the N terminal via a 6-aminohexanoic acid linker

Searchable Words

[LL-37, 37 aa], LL 37 (human) biotinylated, N-terminally biotinylated, host defence, 6-carbon spacer, 6-aminohexanoic acid, Ahx, biotin tag , LL37 (human) biotinylated, AM-003, AM003