LL 37 (Human) Biotinylated, Pegylated

£225.00 1mg

SKU: AM-200 Categories: ,

N-terminally biotinylated version of the host defence peptide LL 37.

LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological applications. LL 37, derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis.

Please contact us for availability.

Additional information

Three Letter Sequence

Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Molecular Weight

4967

Molecular Formula

C226H376N64O59S

Sequence

Biotin-[PEG(4)][LL-37, 37 aa]

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store frozen, dessicated and in the dark

Purity

>95% by HPLC

Modifications

Biotinylation and pegylation on the N terminus

Searchable Words

Biotin-[PEG(4)][LL-37, 37 aa]OH, [LL-37, 37 aa], LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated, biotin, pegylated chain, PEG(4), antimicrobial, antitumour, antiviral, immunomodulatory, chemotaxis, angiogenesis, LL37, AM-200, AM200, LL-37