LL 37 (Human) Biotinylated, Pegylated
£225.00 1mg
N-terminally biotinylated version of the host defence peptide LL 37.
LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological applications. LL 37, derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis.
Please contact us for availability.
Additional information
| Three Letter Sequence | Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
|---|---|
| Molecular Weight | 4967 |
| Molecular Formula | C226H376N64O59S |
| Sequence | Biotin-[PEG(4)][LL-37, 37 aa] |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store frozen, dessicated and in the dark |
| Purity | >95% by HPLC |
| Modifications | Biotinylation and pegylation on the N terminus |
| Searchable Words | Biotin-[PEG(4)][LL-37, 37 aa]OH, [LL-37, 37 aa], LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated, biotin, pegylated chain, PEG(4), antimicrobial, antitumour, antiviral, immunomodulatory, chemotaxis, angiogenesis, LL37, AM-200, AM200, LL-37 |