LL 37 (Human), 5-FAM
£85.00 0.1mg
N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37.
LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fluorescent detection of LL 37. We also offer unlabelled LL 37 (AM-001) and the biotinylated version of LL 37 (AM-003).
Please contact us for availability.
Additional information
| Three Letter Sequence | 5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
|---|---|
| Molecular Weight | 4963.6 |
| Molecular Formula | C226H351N61O58 |
| Sequence | 5FAM-Ahx[LL-37, 37 aa] |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dark, frozen and desiccated |
| Purity | >95% by HPLC |
| Modifications | 5-FAM is attached to the N terminal via a 6-aminohexanoic acid linker |
| Searchable Words | [LL-37, 37 aa], LL 37 (human), 5-FAM , carboxyfluoresceinated, host defence peptide LL 37, fluorescent detection, LL37, AM-004, AM004 |