LL 37 (Human), 5-FAM

£85.00 0.1mg

N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37.

LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fluorescent detection of LL 37. We also offer unlabelled LL 37 (AM-001) and the biotinylated version of LL 37 (AM-003).

Please contact us for availability.

SKU: AM-004 Categories: ,

Additional information

Three Letter Sequence

5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Molecular Weight

4963.6

Molecular Formula

C226H351N61O58

Sequence

5FAM-Ahx[LL-37, 37 aa]

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dark, frozen and desiccated

Purity

>95% by HPLC

Modifications

5-FAM is attached to the N terminal via a 6-aminohexanoic acid linker

Searchable Words

[LL-37, 37 aa], LL 37 (human), 5-FAM , carboxyfluoresceinated, host defence peptide LL 37, fluorescent detection, LL37, AM-004, AM004