GLP-1 (7-37)
£145.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous GLP-1 receptor agonist.
GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.
Please contact us for availability.
Additional information
| Other Names | Glucagon like peptide 1 fragment 7-37 (human) |
|---|---|
| Three Letter Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Molecular Weight | 3355.71 |
| Molecular Formula | C151H228N40O47 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | GLP-1 (7-37), 106612-94-6, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |