GLP-1 (7-37)

£145.00 1mg

Endogenous GLP-1 receptor agonist.

GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.

Please contact us for availability.

SKU: GL-030 Categories: ,

Additional information

Other Names

Glucagon like peptide 1 fragment 7-37 (human)

Three Letter Sequence

H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH

Molecular Weight

3355.71

Molecular Formula

C151H228N40O47

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Solubility

Soluble to 1 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

GLP-1 (7-37), 106612-94-6, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG