GLP-1 (7-37)
£145.00 1mg
Endogenous GLP-1 receptor agonist.
GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.
Please contact us for availability.
Additional information
| Other Names | Glucagon like peptide 1 fragment 7-37 (human) |
|---|---|
| Three Letter Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Molecular Weight | 3355.71 |
| Molecular Formula | C151H228N40O47 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | GLP-1 (7-37), 106612-94-6, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |