GLP-1 (1-37) (human, rat)
£225.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Pancreatic hormone from posttranslational proglucagon proteolysis.
GLP-1 (1-37) is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not affect food intake in rats and does not enhance pancreatic insulin. It is secreted by the small intestine in response to nutrient ingestion with wide-ranging effects on glucose metabolism, including stimulation of insulin release, inhibition of glucagon secretion, reduction of gastric emptying and satiety. The insulinotropic actions of GLP-1 depend on ambient glucose concentrations, making it highly relevant in type 2 diabetes. GLP-1 (1-37) also has an important role in the cardiovascular system.
Please contact us for availability.
Additional information
| Other Names | GLP-1 (1-37) |
|---|---|
| Three Letter Sequence | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Molecular Weight | 4169.5 |
| Molecular Formula | C186H275N51O59 |
| Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | GLP-1 (1-37), pancreatic hormone, proteolysis of proglucagon, food intake, glucose metabolism, insulin release, glucagon secretion, insulinotropic, GLP-1, diabetes. GLP-1 (1-37) , H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, 87805-34-3, GH-020, GH020 |