GLP-1 (1-37) (Human, Rat)
£225.00 1mg
Pancreatic hormone from posttranslational proglucagon proteolysis.
GLP-1 (1-37) is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not affect food intake in rats and does not enhance pancreatic insulin. It is secreted by the small intestine in response to nutrient ingestion with wide-ranging effects on glucose metabolism, including stimulation of insulin release, inhibition of glucagon secretion, reduction of gastric emptying and satiety. The insulinotropic actions of GLP-1 depend on ambient glucose concentrations, making it highly relevant in type 2 diabetes. GLP-1 (1-37) also has an important role in the cardiovascular system.
Please contact us for availability.
Additional information
| Other Names | GLP-1 (1-37) |
|---|---|
| Three Letter Sequence | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Molecular Weight | 4169.5 |
| Molecular Formula | C186H275N51O59 |
| Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | GLP-1 (1-37), pancreatic hormone, proteolysis of proglucagon, food intake, glucose metabolism, insulin release, glucagon secretion, insulinotropic, GLP-1, diabetes. GLP-1 (1-37) , H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, 87805-34-3, GH-020, GH020 |